PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC07G11150.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 426aa    MW: 46493.3 Da    PI: 4.7768
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC07G11150.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.31.5e-32246300155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k+r+rWtpeLHerFv+av+ LGGsekAtPk +l+lmk + Lt++hvkSHLQkYR+
  OPUNC07G11150.2 246 KTRMRWTPELHERFVDAVNLLGGSEKATPKGVLKLMKADNLTIYHVKSHLQKYRT 300
                      68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-30243302IPR009057Homeodomain-like
PROSITE profilePS5129413.059243303IPR017930Myb domain
SuperFamilySSF466891.97E-17245300IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-24246300IPR006447Myb domain, plants
PfamPF002494.1E-10248299IPR001005SANT/Myb domain
PfamPF143791.2E-21333377IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MERISTNQLY NSGIPVTVPS PLPAIPATLD ENFPRIPDGQ NVPRERELRS TPMPPHQNQS  60
TVAPLHGHFQ SSTGSVGPLR SSQAIRFSSV SSNEQYTNAN PYNSQPPSTG SSSTLNYGSQ  120
YGGFEPSVTD FPRDAGPTWC PDPVDGLLGY ADDVPAGNNL TENSSIEATD ELAKQSEWWN  180
DFMNYDWKDV DNVACTETQP QVGPPAQSSV VVHQSAAQQS VSSQSGEPSA VAIPSPTAAS  240
NTSNSKTRMR WTPELHERFV DAVNLLGGSE KATPKGVLKL MKADNLTIYH VKSHLQKYRT  300
ARYRPELSEG SSEKKTASKE DIPSIDLKGG NFDLTEALRL QLELQKRLHE QLEIQRSLQL  360
RIEEQGKCLQ MMLEQQCIPG TDKVVDASTS AEGTKPSSDL PESSTVKDVP ENSQNGIAKE  420
TESGDR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1000650.0AK100065.1 Oryza sativa Japonica Group cDNA clone:J013160O05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647735.10.0PREDICTED: protein PHR1-LIKE 1
RefseqXP_015647736.10.0PREDICTED: protein PHR1-LIKE 1
TrEMBLA0A0E0LJY20.0A0A0E0LJY2_ORYPU; Uncharacterized protein
STRINGLOC_Os07g25710.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA025605-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.12e-70phosphate starvation response 1